ILF3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-58226

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to ILF3 (interleukin enhancer binding factor 3, 90kDa) The peptide sequence was selected from the N terminal of ILF3. Peptide sequence ALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ILF3 Antibody - BSA Free

Western Blot: ILF3 Antibody [NBP1-58226]

Western Blot: ILF3 Antibody [NBP1-58226]

Western Blot: ILF3 Antibody [NBP1-58226] - Titration: 0.2-1 ug/ml, Positive Control: 293T cell lysate.
Immunohistochemistry: ILF3 Antibody [NBP1-58226]

Immunohistochemistry: ILF3 Antibody [NBP1-58226]

Immunohistochemistry: ILF3 Antibody [NBP1-58226] - Paraffin Embedded Tissue: Human Heart Cellular Data: Myocardial cells Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X
Immunohistochemistry-Paraffin: ILF3 Antibody [NBP1-58226]

Immunohistochemistry-Paraffin: ILF3 Antibody [NBP1-58226]

Immunohistochemistry-Paraffin: ILF3 Antibody [NBP1-58226] - Human Liver Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Hepatocytes (indicated with arrows) 400X magnification.
Immunohistochemistry: ILF3 Antibody [NBP1-58226]

Immunohistochemistry: ILF3 Antibody [NBP1-58226]

Immunohistochemistry: ILF3 Antibody [NBP1-58226] - Paraffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubule Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X

Applications for ILF3 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ILF3

ILF3 may facilitate double-stranded RNA-regulated gene expression at the level of post-transcription. ILF3 can act as a translation inhibitory protein which binds to coding sequences of acid beta-glucosidase (GCase) and other mRNAs and functions at the initiation phase of GCase mRNA translation, probably by inhibiting its binding to polysomes. ILF3 can regulate protein arginine N-methyltransferase 1 activity. ILF3 may regulate transcription of the IL2 gene during T-cell activation. It can promote the formation of stable DNA-dependent protein kinase holoenzyme complexes on DNA.Nuclear factor of activated T-cells (NFAT) is a transcription factor required for T-cell expression of interleukin 2. NFAT binds to a sequence in the IL2 enhancer known as the antigen receptor response element 2. In addition, NFAT can bind RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. NFAT is a heterodimer of 45 kDa and 90 kDa proteins, the larger of which is the product of this gene. The encoded protein, which is primarily localized to ribosomes, probably regulates transcription at the level of mRNA elongation. At least three transcript variants encoding three different isoforms have been found for this gene.Nuclear factor of activated T-cells (NFAT) is a transcription factor required for T-cell expression of interleukin 2. NFAT binds to a sequence in the IL2 enhancer known as the antigen receptor response element 2. In addition, NFAT can bind RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. NFAT is a heterodimer of 45 kDa and 90 kDa proteins, the larger of which is the product of this gene. The encoded protein, which is primarily localized to ribosomes, probably regulates transcription at the level of mRNA elongation. At least three transcript variants encoding three different isoforms have been found for this gene.

Alternate Names

Double-stranded RNA-binding protein 76, double-stranded RNA-binding protein, 76 kD, DRBF, DRBP76M-phase phosphoprotein 4, dsRNA binding protein NFAR-2/MPP4, interleukin enhancer binding factor 3, 90kDa, interleukin enhancer-binding factor 3, MPHOSPH4interleukin enhancer binding factor 3, 90kD, MPP4MMP4, NF90CBTF, NFAR-1, NFAR2, NFARNF110, NF-AT-90, Nuclear factor associated with dsRNA, Nuclear factor of activated T-cells 90 kDa, nuclear factor of activated T-cells, 90 kD, TCP110, TCP80, Translational control protein 80

Gene Symbol

ILF3

Additional ILF3 Products

Product Documents for ILF3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ILF3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ILF3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ILF3 Antibody - BSA Free and earn rewards!

Have you used ILF3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...