ILT11/LILRA5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09519

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ILT11/LILRA5 (NP_870994). Peptide sequence GNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEH

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ILT11/LILRA5 Antibody - BSA Free

Western Blot: ILT11/LILRA5 Antibody [NBP3-09519]

Western Blot: ILT11/LILRA5 Antibody [NBP3-09519]

Western Blot: ILT11/LILRA5 Antibody [NBP3-09519] - Western blot analysis of ILT11/LILRA5 in Fetal Lung as a positive control. Antibody dilution at 1.0 ug/ml

Applications for ILT11/LILRA5 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LILRA5/CD85f

The protein encoded by the LILRA5 gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family. LIR family members are known to have activating and inibitory functions in leukocytes. Crosslink of this receptor protein on the surface of monocytes has been shown to induce calcium flux and secretion of several proinflammatory cytokines, which suggests the roles of this protein in triggering innate immune responses. This gene is one of the leukocyte receptor genes that form a gene cluster on the chromosomal region 19q13.4. Four alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq]

Long Name

Leukocyte Immunoglobulin-like Receptor Subfamily A Member 5

Alternate Names

CD85f, ILT11, LILRB7, LIR9

Gene Symbol

LILRA5

Additional LILRA5/CD85f Products

Product Documents for ILT11/LILRA5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ILT11/LILRA5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ILT11/LILRA5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ILT11/LILRA5 Antibody - BSA Free and earn rewards!

Have you used ILT11/LILRA5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...