ILT3/CD85k/LILRB4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09945

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all LILRB4/CD85k/ILT3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen for Anti-ILT3/CD85k/LILRB4 antibody is: synthetic peptide directed towards the C-terminal region of Human LIRB4. Peptide sequence RQGKHRTLAQRQADFQRPPGAAEPEPKDGGLQRRSSPAADVQGENFCAAV

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

49 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ILT3/CD85k/LILRB4 Antibody - BSA Free

Western Blot: ILT3/CD85k/LILRB4 Antibody [NBP3-09945]

Western Blot: ILT3/CD85k/LILRB4 Antibody [NBP3-09945]

Western Blot: ILT3/CD85k/LILRB4 Antibody [NBP3-09945] - Western blot analysis of ILT3/CD85k/LILRB4 in Human OVCAR-3 Whole Cell. Antibody dilution at 1 ug/mL

Applications for ILT3/CD85k/LILRB4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LILRB4/CD85k/ILT3

The LILRB4 gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster atchromosomal region 19q13.4. The encoded protein belongs to the subfamily B class of LIR receptors which contain two orfour extracellular i

Long Name

Leukocyte Immunoglobulin-like Receptor, Subfamily B (with TM and ITIM Domains), Member 4

Alternate Names

CD85k, HM18, ILT3, LIR5

Gene Symbol

LILRB4

Additional LILRB4/CD85k/ILT3 Products

Product Documents for ILT3/CD85k/LILRB4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ILT3/CD85k/LILRB4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ILT3/CD85k/LILRB4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ILT3/CD85k/LILRB4 Antibody - BSA Free and earn rewards!

Have you used ILT3/CD85k/LILRB4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies