ILT6/CD85e/LILRA3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-98549

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all LILRA3/CD85e Primary Antibodies »

Product Specifications

Immunogen

The immunogen for this antibody is LILRA3 - C-terminal region. Peptide sequence AADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHP. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

45 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ILT6/CD85e/LILRA3 Antibody - BSA Free

Western Blot: ILT6/CD85e/LILRA3 Antibody [NBP1-98549]

Western Blot: ILT6/CD85e/LILRA3 Antibody [NBP1-98549]

Western Blot: ILT6/CD85e/LILRA3 Antibody [NBP1-98549] - Human OVCAR-3 Lane A: Primary Antibody Lane B: Primary Antibody + Blocking Peptide. Primary Antibody Concentration: 1.0 ug/mL. Peptide Concentration: 2.0 ug/mL lysate. Quantity: 25 ug/lane.
Western Blot: ILT6/CD85e/LILRA3 Antibody [NBP1-98549]

Western Blot: ILT6/CD85e/LILRA3 Antibody [NBP1-98549]

Western Blot: ILT6/CD85e/LILRA3 Antibody [NBP1-98549] - Antibody Dilution: 1.0ug/ml Sample Tissue: Human Kidney.

Applications for ILT6/CD85e/LILRA3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Reviewed Applications

Read 1 review rated 4 using NBP1-98549 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LILRA3/CD85e

Leukocyte Ig-like receptors (LIRs) are a family of immunoreceptors expressed predominantly on monocytes and B cells and at lower levels on dendritic cells and natural killer (NK) cells. All LIRs in subfamily B have an inhibitory function. LIRs in subfamily A, with short cytoplasmic domains lacking an immunoreceptor tyrosine-based inhibitory motif (ITIM) and with transmembrane regions containing a charged arginine residue, may initiate stimulatory cascades. One member of subfamily A (LILRA3) lacks a transmembrane region and is presumed to be a soluble receptor.

Long Name

Leukocyte Immunoglobulin-like Receptor, Subfamily A (with TM and ITIM Domains), Member 3

Alternate Names

CD85e, HM31, HM43, ILT6, LIR4

Gene Symbol

LILRA3

UniProt

NP_006856

Additional LILRA3/CD85e Products

Product Documents for ILT6/CD85e/LILRA3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ILT6/CD85e/LILRA3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ILT6/CD85e/LILRA3 Antibody - BSA Free (1)

4 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
100%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used ILT6/CD85e/LILRA3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • ILT6/CD85e/LILRA3 Antibody
    Name: Anonymous
    Application: Western Blot
    Sample Tested: Human smooth muscle cells, Sample Amount: 30ug and Human kidney
    Species: Human
    Verified Customer | Posted 11/22/2020
    We received great results from the test! We had some issues at the start, but overall great product! Served well!
    ILT6/CD85e/LILRA3 Antibody - BSA Free NBP1-98549

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies