Importin-13 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86677

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human Importin-13. Peptide sequence: HKAQFPSDEEYGFWSSDEKEQFRIYRVDISDTLMYVYEMLGAELLSNLYD The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Importin-13 Antibody - BSA Free

Western Blot: Importin-13 Antibody [NBP2-86677]

Western Blot: Importin-13 Antibody [NBP2-86677]

Western Blot: Importin-13 Antibody [NBP2-86677] - Host: Rabbit. Target Name: IPO13. Sample Tissue: Human Jurkat Whole Cell. Antibody Dilution: 1.0ug/ml

Applications for Importin-13 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Importin-13

Importin-13 functions in nuclear protein import as nuclear transport receptor. Serves as receptor for nuclear localization signals (NLS) in cargo substrates. Is thought to mediate docking of the importin/substrate complex to the nuclear pore complex (NPC) through binding to nucleoporin and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to the importin, the importin/substrate complex dissociates and importin is re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. Mediates the nuclear import of UBC9, the RBM8A/MAGOH complex, PAX6 and probably other members of the paired homeobox family. Also mediates nuclear export of eIF-1A, and the cytoplasmic release of eIF-1A is triggered by the loading of import substrates onto IPO13. Expressed in fetal brain, heart, intestine and kidney. Belongs to the importin beta family. Contains 14 HEAT repeats. Contains 1 importin N-terminal domain.

Alternate Names

Imp13, importin 13, importin-13, Kap13, karyopherin 13, Karyopherin-13, KIAA0724karyopherin-13, LGL2, Ran binding protein 13, Ran-binding protein 13, RanBP13, RANBP13late gestation lung 2

Gene Symbol

IPO13

Additional Importin-13 Products

Product Documents for Importin-13 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Importin-13 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Importin-13 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Importin-13 Antibody - BSA Free and earn rewards!

Have you used Importin-13 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...