Importin-8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87625

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Importin-8 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human Importin-8. Peptide sequence: PPAVDAVVGQIVPSILFLFLGLKQVCATRQLVNREDRSKAEKADMEENEE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Importin-8 Antibody - BSA Free

Western Blot: Importin-8 Antibody [NBP2-87625]

Western Blot: Importin-8 Antibody [NBP2-87625]

Western Blot: Importin-8 Antibody [NBP2-87625] - WB Suggested Anti-IPO8 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Kidney

Applications for Importin-8 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Importin-8

The importin-alpha/beta complex and the GTPase Ran mediate nuclear import of proteins with a classical nuclear localization signal. The protein encoded by this gene is a member of a class of approximately 20 potential Ran targets that share a sequence motif related to the Ran-binding site of importin-beta. This protein binds to the nuclear pore complex and, along with RanGTP and RANBP1, inhibits the GAP stimulation of the Ran GTPase. [provided by RefSeq]

Alternate Names

FLJ21954, FLJ26580, IMP8, importin 8, importin-8, RAN binding protein 8, Ran-binding protein 8, RanBP8, RANBP8imp8

Gene Symbol

IPO8

Additional Importin-8 Products

Product Documents for Importin-8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Importin-8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Importin-8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Importin-8 Antibody - BSA Free and earn rewards!

Have you used Importin-8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies