INPP4B Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87626

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all INPP4B Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human INPP4B. Peptide sequence: HHSDYDEEEWDRVWANVGKSLNCIIAMVDKLIERDGGSEGSGGNNDGEKE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for INPP4B Antibody - BSA Free

Western Blot: INPP4B Antibody [NBP2-87626]

Western Blot: INPP4B Antibody [NBP2-87626]

Western Blot: INPP4B Antibody [NBP2-87626] - Host: Rabbit. Target Name: INPP4B. Sample Tissue: Human Ovary Tumor. Antibody Dilution: 1.0ug/ml

Applications for INPP4B Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: INPP4B

INPP4B encodes the inositol polyphosphate 4-phosphatase type II, one of the enzymes involved in phosphatidylinositolsignaling pathways. This enzyme removes the phosphate group at position 4 of the inositol ring from inositol3,4-bisphosphate. There is limited data to suggest that the human type II enzyme is subject to alternative splicing,as has been established for the type I enzyme. (provided by RefSeq)

Alternate Names

inositol polyphosphate-4-phosphatase, type II, 105kDa, type II inositol-3,4-bisphosphate 4-phosphatase

Gene Symbol

INPP4B

Additional INPP4B Products

Product Documents for INPP4B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for INPP4B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for INPP4B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review INPP4B Antibody - BSA Free and earn rewards!

Have you used INPP4B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies