INSIG-1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84095

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all INSIG-1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human INSIG-1. Peptide sequence: LAAHGAPDADPAPRGRSAAMSGPEPGSPYPNTWHHRLLQRSLVLFSVGVV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for INSIG-1 Antibody - BSA Free

Western Blot: INSIG-1 Antibody [NBP2-84095]

Western Blot: INSIG-1 Antibody [NBP2-84095]

Western Blot: INSIG-1 Antibody [NBP2-84095] - Host: Rabbit. Target Name: INSIG1. Sample Tissue: Stomach Tumor lysates. Antibody Dilution: 1ug/ml

Applications for INSIG-1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: INSIG-1

Insig1 is an insulin-induced gene. It encodes an endoplasmic reticulum (ER) membrane protein that plays a critical role in regulating cholesterol concentrations in cells.

Oxysterols regulate cholesterol homeostasis through liver X receptor (LXR) and sterol regulatory element-binding protein (SREBP) mediated signaling pathway. Insig1 binds to the sterol-sensing domains of SREBP cleavage-activating protein (SCAP) and HMG CoA reductase, and is essential for the sterol-mediated trafficking of the two proteins. Alternatively spliced transcript variants encoding distinct isoforms have been observed.

Alternate Names

CL6, CL-6, INSIG-1, INSIG-1 membrane protein, insulin induced gene 1, insulin-induced gene 1 protein, MGC1405

Gene Symbol

INSIG1

Additional INSIG-1 Products

Product Documents for INSIG-1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for INSIG-1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for INSIG-1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review INSIG-1 Antibody - BSA Free and earn rewards!

Have you used INSIG-1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies