INSL4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-17385

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all INSL4 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: AAELRGCGPRFGKHLLSYCPMPEKTFTTTPGGWLLESGRPKEMVSTSNNKDGQALGT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for INSL4 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: INSL4 Antibody [NBP3-17385]

Immunocytochemistry/ Immunofluorescence: INSL4 Antibody [NBP3-17385]

Immunocytochemistry/Immunofluorescence: INSL4 Antibody [NBP3-17385] - Staining of human cell line A549 shows localization to vesicles.

Applications for INSL4 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF, PFA/Triton X-100 is recommended for fixation/permeabilization.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: INSL4

Insulin is a secreted peptide hormone that elicits metabolic effects such as increases in glucose uptake and glycogen synthesis leading to a decrease in blood glucose concentration. Insulin is first formed as a precursor molecule, preproinsulin, which is later cleaved to proinsulin and finally to the mature insulin hormone. Insulin-like peptides (INSL proteins), also designated Relaxinlike factors, are members of the insulin family, which regulate cell growth, metabolism and tissue-specific functions. INSL1-7 are mostly secreted proteins that are expressed mainly in testis, placenta, uterus or prenatal tissues. INSL4 is a 139 amino acid secreted protein expressed in the placenta, uterus and in fetal perichondrium. It may play an important role in the regulation of bone formation and in trophoblast development.

Long Name

Insulin-like 4

Alternate Names

EPIL, Placentin

Gene Symbol

INSL4

Additional INSL4 Products

Product Documents for INSL4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for INSL4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for INSL4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review INSL4 Antibody - BSA Free and earn rewards!

Have you used INSL4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies