Integrin beta 8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-87539

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: AQHCVNSKGQVCSGRGTCVCGRCECTDPRSIGRFCEHCPTCYTACKENWNCMQCLHPHNLSQAILDQCKTSCALMEQQHY

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (85%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Integrin beta 8 Antibody - BSA Free

Immunohistochemistry-Paraffin: Integrin beta 8 Antibody [NBP1-87539]

Immunohistochemistry-Paraffin: Integrin beta 8 Antibody [NBP1-87539]

Immunohistochemistry-Paraffin: Integrin beta 8 Antibody [NBP1-87539] - Analysis in human cervix, uterine and liver tissues using NBP1-87539 antibody. Corresponding Integrin beta 8 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Integrin beta 8 Antibody [NBP1-87539]

Immunohistochemistry-Paraffin: Integrin beta 8 Antibody [NBP1-87539]

Immunohistochemistry-Paraffin: Integrin beta 8 Antibody [NBP1-87539] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Integrin beta 8 Antibody [NBP1-87539]

Immunohistochemistry-Paraffin: Integrin beta 8 Antibody [NBP1-87539]

Immunohistochemistry-Paraffin: Integrin beta 8 Antibody [NBP1-87539] - Staining of human cervix, uterine shows strong membranous positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: Integrin beta 8 Antibody [NBP1-87539]

Immunohistochemistry-Paraffin: Integrin beta 8 Antibody [NBP1-87539]

Immunohistochemistry-Paraffin: Integrin beta 8 Antibody [NBP1-87539] - Staining of human kidney shows strong membranous positivity in cells in tubules.
Immunohistochemistry-Paraffin: Integrin beta 8 Antibody [NBP1-87539]

Immunohistochemistry-Paraffin: Integrin beta 8 Antibody [NBP1-87539]

Immunohistochemistry-Paraffin: Integrin beta 8 Antibody [NBP1-87539] - Staining of human endometrium shows strong membranous positivity in glandular cells.

Applications for Integrin beta 8 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Integrin beta 8

The Integrin beta 8 gene is a member of the integrin beta chain family and encodes a single-pass type I membrane protein with a VWFA domain and four cysteine-rich repeats. This protein noncovalently binds to an alpha subunit to form a heterodimeric integrin complex. In

Alternate Names

ITGB8

Gene Symbol

ITGB8

Additional Integrin beta 8 Products

Product Documents for Integrin beta 8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Integrin beta 8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Integrin beta 8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Integrin beta 8 Antibody - BSA Free and earn rewards!

Have you used Integrin beta 8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies