Integrin beta-like protein 1 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-02975

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Integrin beta-like protein 1 (NP_004782.1). CYCGNCYCKAGWHGDKCEFQCDITPWESKRRCTSPDGKICSNRGTCVCGECTCHDVDPTGDWGDIHGDTCECDERDCRAVYDRYSDDFCSGHGQCNCGRCD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Integrin beta-like protein 1 Antibody - Azide and BSA Free

Western Blot: Integrin beta-like protein 1 AntibodyAzide and BSA Free [NBP3-02975]

Western Blot: Integrin beta-like protein 1 AntibodyAzide and BSA Free [NBP3-02975]

Western Blot: Integrin beta-like protein 1 Antibody [NBP3-02975] - Analysis of extracts of various cell lines, using Integrin beta-like protein 1 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection:Basic ECL Kit

Applications for Integrin beta-like protein 1 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ITGBL1

Integrins are transmembrane proteins that mediate interactions between adhesion molecules on adjacent cells and/or the extracellular matrix (ECM). Integrins have diverse roles in several biological processes including cell migration during development and wound healing, cell differentiation, and apoptosis. Their activities can also regulate the metastatic and invasive potential of tumor cells. They exist as heterodimers consisting of alpha and beta subunits. Some alpha and beta subunits exhibit specificity for one another and may be designated as a VLA (very late antigen) member. Heterodimers often preferentially bind certain cell adhesion molecules, or constituents of the ECM. Although they have no catalytic activity, integrins can be part of multimolecular signaling complexes known as focal adhesions.

Long Name

Integrin beta-like 1

Alternate Names

Integrin beta-like 1, OSCP, TIED

Gene Symbol

ITGBL1

Additional ITGBL1 Products

Product Documents for Integrin beta-like protein 1 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Integrin beta-like protein 1 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for Integrin beta-like protein 1 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Integrin beta-like protein 1 Antibody - Azide and BSA Free and earn rewards!

Have you used Integrin beta-like protein 1 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...