Inversin Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10988

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human Inversin (NP_055240). Peptide sequence ALLKAGADVNKTDHSQRTALHLAAQKGNYRFMKLLLTRRANWMQKDLEEM

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

117 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Inversin Antibody - BSA Free

Western Blot: Inversin Antibody [NBP3-10988]

Western Blot: Inversin Antibody [NBP3-10988]

Western Blot: Inversin Antibody [NBP3-10988] - Western blot analysis of Inversin in Human MCF7 Whole Cell lysates. Antibody dilution at 3ug/ml

Applications for Inversin Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Inversin

Inversin encodes a protein containing multiple ankyrin domains and two IQ calmodulin-binding domains. The encoded protein may function in renal tubular development and function, and in left-right axis determination. This protein interacts with nephrocystin and infers a connection between primary cilia function and left-right axis determination. A similar protein in mice interacts with calmodulin. Mutations in this gene have been associated with nephronophthisis type 2. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]

Alternate Names

inversin, Inversion of embryo turning homolog, INVMGC133081, KIAA0573, MGC133080, nephrocystin 2, Nephrocystin-2, nephronophthisis 2 (infantile), NPH2, NPHP2inversion of embryonic turning

Gene Symbol

INVS

Additional Inversin Products

Product Documents for Inversin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Inversin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Inversin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Inversin Antibody - BSA Free and earn rewards!

Have you used Inversin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...