IRX1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85107

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human IRX1. Peptide sequence: RSSPTLPERDLVPRPDSPAQQLKSPFQPVRDNSLAPQEGTPRILAALPSA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for IRX1 Antibody - BSA Free

Western Blot: IRX1 Antibody [NBP2-85107]

Western Blot: IRX1 Antibody [NBP2-85107]

Western Blot: IRX1 Antibody [NBP2-85107] - WB Suggested Anti-IRX1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: Human Stomach
Western Blot: IRX1 Antibody [NBP2-85107]

Western Blot: IRX1 Antibody [NBP2-85107]

Western Blot: IRX1 Antibody [NBP2-85107] - Host: Rabbit. Target: IRX1. Positive control (+): Human Lung (LU). Negative control (-): 293T Cell Lysate (2T). Antibody concentration: 1ug/ml

Applications for IRX1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: IRX1

The Iroquois homeobox gene family of transcription factors regulate aspects of embryonic development including anterior/posterior and dorsal/ventral axis patterning in the central nervous system. The Iroquois family are clustered on two loci, IRXA and IRXB, which map to chromosomes 8 and 13 in mice. The IRXA group includes Irx1, Irx2 and Irx4; the IRXB group is comprises Irx3, Irx5 and Irx6. Irx1 and Irx2 are both widely expressed during development in the lung epithelium and also in the ventricular septum. Irx1 and Irx2 also play a role in digit formation (E11.5-E14.5). The Irx gene family members are each expressed in a distinct pattern during mouse heart development. Specifically, Irx1 and Irx2 are expressed in the ventricular septum and Irx3 is expressed in the ventricular trabeculated myocardium. In addition, Irx4 is expressed in the linear heart tube and the AV canal; Irx5 is expressed in the endocardium lining the ventricular and atrial myocardium. Furthermore, the IRX4 gene may modulate cardiac development and function. Although the heart of Irx4- mice appears to develop normally, adult Irx4- mice exhibit cardiomyopathy, including cardiac hypertrophy and decreased contractility.

Alternate Names

Homeodomain protein IRXA1, iroquois homeobox 1, Iroquois homeobox protein 1, iroquois-class homeodomain protein IRX-1, IRX-5, IRXA1

Gene Symbol

IRX1

Additional IRX1 Products

Product Documents for IRX1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for IRX1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for IRX1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review IRX1 Antibody - BSA Free and earn rewards!

Have you used IRX1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...