JDP2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85123

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all JDP2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of mouse JDP2. Peptide sequence: LKTQIEELKLERQQLILMLNRHRPTCIVRTDSVRTPESEGNPLLEQLDKK The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for JDP2 Antibody - BSA Free

Western Blot: JDP2 Antibody [NBP2-85123]

Western Blot: JDP2 Antibody [NBP2-85123]

Western Blot: JDP2 Antibody [NBP2-85123] - WB Suggested Anti-Jundm2 Antibody Titration: 0.2-1 ug/ml. Positive Control: Mouse Heart

Applications for JDP2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: JDP2

JDP2 is a gene which codes for a protein that helps to repress transactivation as well as controlling responses such as apoptosis, tumorigenesis, cell differentiation, and antitumogeneris via the modification of histones along with chromatin assembly and is comprised of 163 amino acids, weighs approximately 19 kDa. Studies have been conducted on diseases and disorders relating to this gene including intracranial aneurysms, keratitis, carcinoma, rhabdomyosarcoma, pancreatitis, leukemia, and skeletal muscle neoplasm. JDP2 has also been shown to have interactions with JUND, JUNB, JUN, PGR, and EEF1G in pathways such as the ATF-2 transcription factor and tacrolimus/cyclosporine pathways.

Alternate Names

Jun dimerization protein 2, JUNDM2, progesterone receptor co-activator

Gene Symbol

JDP2

Additional JDP2 Products

Product Documents for JDP2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for JDP2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for JDP2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review JDP2 Antibody - BSA Free and earn rewards!

Have you used JDP2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies