JNK/JIP3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87650

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of JNK/JIP3. Peptide sequence: QYEREKALRRQAEEKFIEFEDALEQEKKELQIQVEHYEFQTRQLELKAKN The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for JNK/JIP3 Antibody - BSA Free

Western Blot: JNK/JIP3 Antibody [NBP2-87650]

Western Blot: JNK/JIP3 Antibody [NBP2-87650]

Western Blot: JNK/JIP3 Antibody [NBP2-87650] - WB Suggested Anti-MAPK8IP3 Antibody. Titration: 1.0 ug/ml. Positive Control: Placenta

Applications for JNK/JIP3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: JNK/JIP3

c-Jun NH2-terminal kinases (JNKs) are distant members of the MAP kinase family. JNK1 is activated by dual phosphorylation at a Thr-Pro-Tyr motif in response to ultraviolet (UV) light, and it functions to phosphorylate c-Jun at amino terminal serine regulatory sites Ser 63 and Ser 73, resulting in transcriptional activation. Two additional JNK family members, JNK2 and JNK3, have been identified. JIP-1 (for JNK interacting protein-1) has been identified as a cytoplasmic inhibitor of JNK that retains JNK in the cytoplasm, thereby inhibiting JNK-regulated gene expression. Evidence suggests that JNK1 and JNK2 bind to JIP-1 with greater affinity than to ATF-2 and c-Jun, which are targets of the JNK signaling pathway. JIP-1 contains an amino terminal JNK binding domain and a carboxy terminal SH3 domain. ATF-2 and c-Jun also contain the JNK binding domain and are thought to compete with JIP-1 for JNK binding. Multiple splice variants of JIP-1, including JIP-1b, JIP-1c (also designated islet-brain 1 or IB-1), JIP-2a, JIP-2b and JIP-3, have been identified in brain.

Alternate Names

C-jun-amino-terminal kinase interacting protein 3, C-Jun-amino-terminal kinase-interacting protein 3, DKFZp762N1113, homolog of Drosophila Sunday driver 2, JIP-3, JIP3FLJ00027, JNK MAP kinase scaffold protein 3, JNK/SAPK-associated protein-1, JNK/stress-activated protein kinase-associated protein 1, JNK-interacting protein 3, JSAP1, KIAA1066SYD2, mitogen-activated protein kinase 8 interacting protein 3, Mitogen-activated protein kinase 8-interacting protein 3, syd

Gene Symbol

MAPK8IP3

Additional JNK/JIP3 Products

Product Documents for JNK/JIP3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for JNK/JIP3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for JNK/JIP3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review JNK/JIP3 Antibody - BSA Free and earn rewards!

Have you used JNK/JIP3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...