Kaiso Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35285

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Chromatin Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Kaiso Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 523-672 of human Kaiso (NP_006768.1).

Sequence:
PCRYCEKVFPLAEYRTKHEIHHTGERRYQCLACGKSFINYQFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQYAYLSDRSSTIPAMKDDGIGYKVDTGKEPPVGTTTSTQNKPMTWEDIFIQQENDSIFKQNVTDGSTEFEFIIPESY

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Kaiso Antibody - BSA Free

Kaiso Antibody

Western Blot: Kaiso Antibody [NBP3-35285] -

Western Blot: Kaiso Antibody [NBP3-35285] - Western blot analysis of various lysates using Kaiso Rabbit pAb at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit.
Exposure time: 90s.
Kaiso Antibody

Chromatin Immunoprecipitation: Kaiso Antibody [NBP3-35285] -

Chromatin Immunoprecipitation: Kaiso Antibody [NBP3-35285] - Chromatin immunoprecipitation analysis of extracts of HeLa cells, using Kaiso antibody and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Applications for Kaiso Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation

5ug antibody for 10ug-15ug of Chromatin

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Western Blot

1:1000 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Kaiso

KAISO is a transcriptional regulator that binds, via its zinc fingers, to DNA sequences containing methylated CGCG or to the consensus KAISO-binding site (KBS) TCCTGCNA (Filion et al., 2006 (PubMed 16354688)).(supplied by OMIM)

Alternate Names

KAISOkaiso transcription factor, transcriptional regulator Kaiso, WUGSC:H_DJ525N14.1, zinc finger and BTB domain containing 33, Zinc finger and BTB domain-containing protein 33, ZNF348kaiso, ZNF-kaiso

Gene Symbol

ZBTB33

Additional Kaiso Products

Product Documents for Kaiso Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Kaiso Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Kaiso Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Kaiso Antibody - BSA Free and earn rewards!

Have you used Kaiso Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies