Karyopherin (importin) beta 3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79535

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human RANBP5. Peptide sequence GNNQWPEGLKFLFDSVSSQNVGLREAALHIFWNFPGIFGNQQQHYLDVIK. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

125 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Karyopherin (importin) beta 3 Antibody - BSA Free

Western Blot: Karyopherin (importin) beta 3 Antibody [NBP1-79535]

Western Blot: Karyopherin (importin) beta 3 Antibody [NBP1-79535]

Western Blot: Karyopherin (importin) beta 3 Antibody [NBP1-79535] - Sample Type: HEK 293 (10ug) Primary Dilution: 1:1000 Secondary Antibody: conjugated goat anti-rabbit Secondary Dilution: 1:10,000 Image Submitted By: Amy Gray Brigham Young University.
Western Blot: Karyopherin (importin) beta 3 Antibody [NBP1-79535]

Western Blot: Karyopherin (importin) beta 3 Antibody [NBP1-79535]

Western Blot: Karyopherin (importin) beta 3 Antibody [NBP1-79535] - Jurkat cell lysate, Antibody Titration: 0.2-1 ug/ml

Applications for Karyopherin (importin) beta 3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Karyopherin (importin) beta 3

Nucleocytoplasmic transport, a signal- and energy-dependent process, takes place through nuclear pore complexes embedded in the nuclear envelope. The import of proteins containing a nuclear localization signal (NLS) requires the NLS import receptor, a heterodimer of importin alpha and beta subunits also known as karyopherins. Importin alpha binds the NLS-containing cargo in the cytoplasm and importin beta docks the complex at the cytoplasmic side of the nuclear pore complex. In the presence of nucleoside triphosphates and the small GTP binding protein Ran, the complex moves into the nuclear pore complex and the importin subunits dissociate. Importin alpha enters the nucleoplasm with its passenger protein and importin beta remains at the pore. Interactions between importin beta and the FG repeats of nucleoporins are essential in translocation through the pore complex. The protein encoded by this gene is a member of the importin beta family.

Alternate Names

DKFZp686O1576, FLJ43041, IMB3, Imp5, importin 5, importin beta-3 subunit, Importin subunit beta-3, importin-5, karyopherin (importin) beta 3, Karyopherin beta-3, KPNB3, MGC2068, RAN binding protein 5, Ran_GTP binding protein 5, Ran-binding protein 5, RANBP5

Gene Symbol

IPO5

Additional Karyopherin (importin) beta 3 Products

Product Documents for Karyopherin (importin) beta 3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Karyopherin (importin) beta 3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Karyopherin (importin) beta 3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Karyopherin (importin) beta 3 Antibody - BSA Free and earn rewards!

Have you used Karyopherin (importin) beta 3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...