KCNE1-like Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83103

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all KCNE1-like Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human KCNE1-like. Peptide sequence: RLRTLLSRLLLELHHRGNASGLGAGPRPSMGMGVVPDPFVGREVTSAKGD The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for KCNE1-like Antibody - BSA Free

Western Blot: KCNE1-like Antibody [NBP2-83103]

Western Blot: KCNE1-like Antibody [NBP2-83103]

Western Blot: KCNE1-like Antibody [NBP2-83103] - Host: Rabbit. Target Name: KCNE1L. Sample Tissue: Human Ovary Tumor. Antibody Dilution: 1.0ug/ml

Applications for KCNE1-like Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KCNE1-like

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a membrane protein which has sequence similarity to the KCNE1 gene product, a member of the potassium channel, voltage-gated, isk-related subfamily. This intronless gene is deleted in AMME contiguous gene syndrome and may be involved in the cardiac and neurologic abnormalities found in the AMME contiguous gene syndrome. (provided by RefSeq)

Alternate Names

AMME syndrome candidate gene 2 protein, AMMECR2, AMMECR2 protein, cardiac voltage-gated potassium channel accessory subunit 5, KCNE1-like, KCNE5, potassium voltage-gated channel subfamily E member 1-like protein, potassium voltage-gated channel, Isk-related family, member 1-like

Gene Symbol

KCNE1L

Additional KCNE1-like Products

Product Documents for KCNE1-like Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for KCNE1-like Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for KCNE1-like Antibody - BSA Free

There are currently no reviews for this product. Be the first to review KCNE1-like Antibody - BSA Free and earn rewards!

Have you used KCNE1-like Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies