KCNK10 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87664

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human KCNK10. Peptide sequence: EKAEFLRDHVCVSPQELETLIQHALDADNAGVSPIGNSSNNSSHWDLGSA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for KCNK10 Antibody - BSA Free

Western Blot: KCNK10 Antibody [NBP2-87664]

Western Blot: KCNK10 Antibody [NBP2-87664]

Western Blot: KCNK10 Antibody [NBP2-87664] - WB Suggested Anti-KCNK10 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: Human brain

Applications for KCNK10 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KCNK10

KCNK10, also known as Potassium channel subfamily K member 10, has 3 isoforms, Isoform A that is 538 amino acid and app. 60 kDa, Isoform B that is 543 amino acid and app. 60 kDa, and Isoform C That is 543 amino acid and app. 60 kDa; expressed in pancreas and kidney and to a lower level in brain, testis, colon, and small intestine; belongs to the family of potassium channel proteins containing two pore-forming P domains; outwards rectifying potassium channel, produces rapidly activating and non-inactivating outward rectifier K(+) currents, activated by arachidonic acid and other naturally occurring unsaturated free fatty acids. Studies are being performed on the relationship of this protein with dentin sensitivity, brain ischemia, and ischemia. The protein has been shown to interact with AKAP150 protein and has been involved in several pathways including cholera infection, neuropathic pain-signaling in dorsal horn neurons, hepatic ABC transporters, PKA signaling, potassium transporters - outward current, gastric, and sweet taste signaling.

Long Name

Potassium channel subfamily K member 10

Alternate Names

TREK2

Gene Symbol

KCNK10

Additional KCNK10 Products

Product Documents for KCNK10 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for KCNK10 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for KCNK10 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review KCNK10 Antibody - BSA Free and earn rewards!

Have you used KCNK10 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...