KCNK12 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80084

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all KCNK12 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the middle region of human KCNK12. Peptide sequence EGRRLSGELISMRDLTASNKVSLALLQKQLSETANGYPRSVCVNTRQNGF. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for KCNK12 Antibody - BSA Free

Western Blot: KCNK12 Antibody [NBP1-80084]

Western Blot: KCNK12 Antibody [NBP1-80084]

Western Blot: KCNK12 Antibody [NBP1-80084] - OVCAR-3 cell lysate, concentration 0.2-1 ug/ml.

Applications for KCNK12 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KCNK12

KCNK12 is a gene which codes for a protein that functions as a potassium channel subunit that most likely needs to associate with another protein subunit in order to properly create a potassium channel and consists of 430 amino acids and weighs approximately 47 kDa. Current studies are being done on diseases and disorders relating to this gene including generalized epilepsy, migranes, vitiligo, pancreatitis, and neuronitis. KCNK12 has also been shown to have importance in pathways such as the cholera infection, hepatic ABC transporter, PKA signaling, and sweet taste signaling pathways.

Alternate Names

potassium channel subfamily K member 12, potassium channel, subfamily K, member 12, tandem pore domain potassium channel THIK-2, THIK2, THIK-2, THIK-2THIK2Tandem pore domain halothane-inhibited potassium channel 2

Gene Symbol

KCNK12

UniProt

NP_071338 (Human)

Additional KCNK12 Products

Product Documents for KCNK12 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for KCNK12 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for KCNK12 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review KCNK12 Antibody - BSA Free and earn rewards!

Have you used KCNK12 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies