KCNK13 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86690

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human KCNK13. Peptide sequence: GEMISMKDLLAANKASLAILQKQLSEMANGCPHQTSTLARDNEFSGGVGA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for KCNK13 Antibody - BSA Free

Western Blot: KCNK13 Antibody [NBP2-86690]

Western Blot: KCNK13 Antibody [NBP2-86690]

Western Blot: KCNK13 Antibody [NBP2-86690] - WB Suggested Anti-KCNK13 Antibody Titration: 0.12ug/ml. ELISA Titer: 1:1562500. Positive Control: Jurkat cell lysate
Immunohistochemistry: KCNK13 Antibody [NBP2-86690]

Immunohistochemistry: KCNK13 Antibody [NBP2-86690]

Immunohistochemistry: KCNK13 Antibody [NBP2-86690] - Researcher: Delphine Bichet, University of Nice-Sophia-Antipolis. Application: IHC. Species + Tissue/Cell type: MDCK Cells. Primary antibody dilution: 1:100. Secondary antibody: Anti-rabbit-Alexa488. Secondary antibody dilution: 1:1000
Western Blot: KCNK13 Antibody [NBP2-86690]

Western Blot: KCNK13 Antibody [NBP2-86690]

Western Blot: KCNK13 Antibody [NBP2-86690] - Host: Rabbit. Target Name: KCNK13. Sample Type: 721_B. Antibody Dilution: 1.0ug/mlKCNK13 is supported by BioGPS gene expression data to be expressed in 721_B
Immunohistochemistry-Paraffin: KCNK13 Antibody [NBP2-86690]

Immunohistochemistry-Paraffin: KCNK13 Antibody [NBP2-86690]

Immunohistochemistry-Paraffin: KCNK13 Antibody [NBP2-86690] - Rabbit Anti-Q9HB14 Antibody. Paraffin Embedded Tissue: Human Brain. Cellular Data: Neural Cells. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X.

Applications for KCNK13 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KCNK13

The KCNK13 gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming domains. The product of this gene is an open channel that can be stimulated by arachidonic acid. (provided by RefSeq)

Alternate Names

K2p13.1, potassium channel subfamily K member 13, potassium channel, subfamily K, member 13, tandem pore domain potassium channel THIK-1, THIK-1

Gene Symbol

KCNK13

Additional KCNK13 Products

Product Documents for KCNK13 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for KCNK13 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for KCNK13 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review KCNK13 Antibody - BSA Free and earn rewards!

Have you used KCNK13 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...