KCNK4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86691

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all KCNK4 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human KCNK4. Peptide sequence: LVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGLLIKEVA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for KCNK4 Antibody - BSA Free

Western Blot: KCNK4 Antibody [NBP2-86691]

Western Blot: KCNK4 Antibody [NBP2-86691]

Western Blot: KCNK4 Antibody [NBP2-86691] - Host: Rabbit. Target Name: KCNK4. Sample Type: Colorectal Tumor lysates. Antibody Dilution: 1.0ug/ml

Applications for KCNK4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KCNK4

Potassium channels play a role in many cellular processes including maintenance of the action potential, muscle contraction, hormone secretion, osmotic regulation, and ion flow. This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The encoded protein homodimerizes and functions as an outwardly rectifying channel. It is expressed primarily in neural tissues and is stimulated by membrane stretch and polyunsaturated fatty acids. (provided by RefSeq)

Long Name

Potassium channel subfamily K member 4

Alternate Names

TRAAK

Gene Symbol

KCNK4

Additional KCNK4 Products

Product Documents for KCNK4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for KCNK4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for KCNK4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review KCNK4 Antibody - BSA Free and earn rewards!

Have you used KCNK4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies