KCNK5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85136

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all KCNK5 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KCNK5. Peptide sequence: HKAIKKRRRRRKESFESSPHSRKALQVKGSTASKDVNIFSFLSKKEETYN The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for KCNK5 Antibody - BSA Free

Western Blot: KCNK5 Antibody [NBP2-85136]

Western Blot: KCNK5 Antibody [NBP2-85136]

Western Blot: KCNK5 Antibody [NBP2-85136] - Host: Rabbit. Target Name: KCNK5. Sample Tissue: Human 293T Whole Cell. Antibody Dilution: 1.0ug/ml

Applications for KCNK5 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KCNK5

KCNK5 encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The message for this gene is mainly expressed in the cortical distal tubules and collecting ducts of the kidney. The protein is highly sensitive to external pH and this, in combination with its expression pattern, suggests it may play an important role in renal potassium transport.

Alternate Names

Acid-sensitive potassium channel protein TASK-2, FLJ11035, K2p5.1, potassium channel subfamily K member 5, potassium channel, subfamily K, member 1 (TASK-2), potassium channel, subfamily K, member 5, TASK-2, TASK2K2P5.1 potassium channel, TWIK-related acid-sensitive K(+) channel 2, TWIK-related acid-sensitive K+ channel 2

Gene Symbol

KCNK5

Additional KCNK5 Products

Product Documents for KCNK5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for KCNK5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for KCNK5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review KCNK5 Antibody - BSA Free and earn rewards!

Have you used KCNK5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies