KCNN3 Antibody (3G7W0)

Novus Biologicals | Catalog # NBP3-33423

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 3G7W0
View all KCNN3 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 631-731 of human KCNN3 (NP_002240.3).

Sequence:
LSKMQNVMYDLITELNDRSEDLEKQIGSLESKLEHLTASFNSLPLLIADTLRQQQQQLLSAIIEARGVSVAVGTTHTPISDSPIGVSSTSFPTPYTSSSSC

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

81 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for KCNN3 Antibody (3G7W0)

KCNN3 Antibody (3G7W0)

Western Blot: KCNN3 Antibody (3G7W0) [NBP3-33423] -

Western Blot: KCNN3 Antibody (3G7W0) [NBP3-33423] - Western blot analysis of various lysates, using KCNN3 Rabbit mAb at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.

Applications for KCNN3 Antibody (3G7W0)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:1000 - 1:5000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: KCNN3

Action potentials in vertebrate neurons are followed by an afterhyperpolarization (AHP) that may persist for several seconds and may have profound consequences for the firing pattern of the neuron. Each component of the AHP is kinetically distinct and is mediated by different calcium-activated potassium channels. The protein encoded by this gene is activated before membrane hyperpolarization and is thought to regulate neuronal excitability by contributing to the slow component of synaptic AHP. The encoded protein is an integral membrane protein that forms a voltage-independent calcium-activated channel with three other calmodulin-binding subunits. This gene contains two CAG repeat regions in the coding sequence. It was thought that expansion of one or both of these repeats could lead to an increased susceptibility to schizophrenia or bipolar disorder, but studies indicate that this is probably not the case. This gene is a member of the KCNN family of potassium channel genes. Two transcript variants encoding two different isoforms have been found for this gene. One of the variants lacks the CAG repeat regions.

Long Name

Small conductance calcium-activated potassium channel protein 3

Alternate Names

K3, KCa2.3, SK3, SKCa 3, SKCa3

Gene Symbol

KCNN3

Additional KCNN3 Products

Product Documents for KCNN3 Antibody (3G7W0)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for KCNN3 Antibody (3G7W0)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for KCNN3 Antibody (3G7W0)

There are currently no reviews for this product. Be the first to review KCNN3 Antibody (3G7W0) and earn rewards!

Have you used KCNN3 Antibody (3G7W0)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies