KCTD2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09612

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all KCTD2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human KCTD2 (NP_056168). Peptide sequence LVRLVKERIRDNENRTSQGPVKHVYRVLQCQEEELTQMVSTMSDGWKFEQ

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for KCTD2 Antibody - BSA Free

Western Blot: KCTD2 Antibody [NBP3-09612]

Western Blot: KCTD2 Antibody [NBP3-09612]

Western Blot: KCTD2 Antibody [NBP3-09612] - Western blot analysis of KCTD2 in RPMI-8226 Whole Cell lysates. Antibody dilution at 1.0ug/ml

Applications for KCTD2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KCTD2

KCTD2 (Potassium Channel Tetramerisation Domain Containing 2) is involved in potassium channel activity. KCTD2 is known to interact with CALR, JMJD6, KCTD5, PSMD2 and RAB3IL1.

Alternate Names

BTB/POZ domain-containing protein KCTD2, potassium channel tetramerisation domain containing 2

Gene Symbol

KCTD2

Additional KCTD2 Products

Product Documents for KCTD2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for KCTD2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for KCTD2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review KCTD2 Antibody - BSA Free and earn rewards!

Have you used KCTD2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies