KIF3B Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82236

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse KIF3B. Peptide sequence: GGGEEEEEEGEEGEEDGDDKDDYWREQQEKLEIEKRAIVEDHSLVAEEKM The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

82 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for KIF3B Antibody - BSA Free

Western Blot: KIF3B Antibody [NBP2-82236]

Western Blot: KIF3B Antibody [NBP2-82236]

Western Blot: KIF3B Antibody [NBP2-82236] - Host: Rabbit. Target Name: Kif3b. Sample Type: Mouse Thymus lysates. Antibody Dilution: 1.0ug/ml
Western Blot: KIF3B Antibody [NBP2-82236]

Western Blot: KIF3B Antibody [NBP2-82236]

Western Blot: KIF3B Antibody [NBP2-82236] - Host: Rabbit. Target Name: KIF3B. Sample Tissue: Mouse Liver. Antibody Dilution: 1ug/ml

Applications for KIF3B Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KIF3B

KIF3B is encoded by this gene acts as a heterodimer with kinesin family member 3A to aid in chromosome movement during mitosis and meiosis. The encoded protein is a plus end-directed microtubule motor and can interact with the SMC3 subunit of the cohesin complex. In addition, the encoded protein may be involved in the intracellular movement of membranous organelles. This protein and kinesin family member 3A form the kinesin II subfamily of the kinesin superfamily. [provided by RefSeq]

Alternate Names

HH0048, KIAA0359Microtubule plus end-directed kinesin motor 3B, kinesin family member 3B, kinesin-like protein KIF3B

Gene Symbol

KIF3B

Additional KIF3B Products

Product Documents for KIF3B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for KIF3B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for KIF3B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review KIF3B Antibody - BSA Free and earn rewards!

Have you used KIF3B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...