Kir2.2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87693

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Kir2.2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human Kir2.2. Peptide sequence: KDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQAR The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Kir2.2 Antibody - BSA Free

Western Blot: Kir2.2 Antibody [NBP2-87693]

Western Blot: Kir2.2 Antibody [NBP2-87693]

Western Blot: Kir2.2 Antibody [NBP2-87693] - Host: Rabbit. Target Name: KCNJ12. Sample Type: Human Adult Placenta. Antibody Dilution: 1.0ug/ml
Immunohistochemistry-Paraffin: Kir2.2 Antibody [NBP2-87693]

Immunohistochemistry-Paraffin: Kir2.2 Antibody [NBP2-87693]

Immunohistochemistry-Paraffin: Kir2.2 Antibody [NBP2-87693] - Rabbit Anti-KCNJ12 antibody. Formalin Fixed Paraffin Embedded Tissue: Human Adult Skeletal muscle. Observed Staining: Cytoplasm in hepatocytes. Primary Antibody Concentration: 1:600. Secondary Antibody: Donkey anti-Rabbit-Cy3. Se
Western Blot: Kir2.2 Antibody [NBP2-87693]

Western Blot: Kir2.2 Antibody [NBP2-87693]

Western Blot: Kir2.2 Antibody [NBP2-87693] - WB Suggested Anti-KCNJ12 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Human brain
Western Blot: Kir2.2 Antibody [NBP2-87693]

Western Blot: Kir2.2 Antibody [NBP2-87693]

Western Blot: Kir2.2 Antibody [NBP2-87693] - Host: Rabbit. Target Name: KCNJ12. Sample Type: Human Fetal Pancreas. Antibody Dilution: 1.0ug/ml
Western Blot: Kir2.2 Antibody [NBP2-87693]

Western Blot: Kir2.2 Antibody [NBP2-87693]

Western Blot: Kir2.2 Antibody [NBP2-87693] - Host: Rabbit. Target Name: KCNJ12. Sample Type: Human Fetal Brain. Antibody Dilution: 1.0ug/ml
Western Blot: Kir2.2 Antibody [NBP2-87693]

Western Blot: Kir2.2 Antibody [NBP2-87693]

Western Blot: Kir2.2 Antibody [NBP2-87693] - Host: Rabbit. Target Name: KCNJ12. Sample Type: Human Fetal Heart. Antibody Dilution: 1.0ug/ml
Western Blot: Kir2.2 Antibody [NBP2-87693]

Western Blot: Kir2.2 Antibody [NBP2-87693]

Western Blot: Kir2.2 Antibody [NBP2-87693] - Host: Rabbit. Target Name: KCNJ12. Sample Type: Human Fetal Lung. Antibody Dilution: 1.0ug/ml
Western Blot: Kir2.2 Antibody [NBP2-87693]

Western Blot: Kir2.2 Antibody [NBP2-87693]

Western Blot: Kir2.2 Antibody [NBP2-87693] - Host: Rabbit. Target Name: KCNJ12. Sample Type: Human Fetal Liver. Antibody Dilution: 1.0ug/ml
Western Blot: Kir2.2 Antibody [NBP2-87693]

Western Blot: Kir2.2 Antibody [NBP2-87693]

Western Blot: Kir2.2 Antibody [NBP2-87693] - Host: Rabbit. Target Name: KCNJ12. Sample Type: Human Fetal Muscle. Antibody Dilution: 1.0ug/ml
Western Blot: Kir2.2 Antibody [NBP2-87693]

Western Blot: Kir2.2 Antibody [NBP2-87693]

Western Blot: Kir2.2 Antibody [NBP2-87693] - Host: Rabbit. Target Name: KCNJ12. Sample Type: Human Fetal Stomach. Antibody Dilution: 1.0ug/ml

Applications for Kir2.2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Kir2.2

FUNCTION: Probably participates in establishing action potential waveform and excitability of neuronal and muscle tissues. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by extracellular barium and cesium. Tissue specificity: Highest level in cerebellum. Moderately found in kidney, forebrain and skeletal muscle. Not detected in uterus, liver and pancreas. Subcellular location: Membrane, Multi-pass membrane protein.

Long Name

ATP-sensitive inward rectifier potassium channel 12

Alternate Names

IRK-2, IRK2, KCNJ12, KCNJN1

Gene Symbol

KCNJ12

Additional Kir2.2 Products

Product Documents for Kir2.2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Kir2.2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Kir2.2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Kir2.2 Antibody - BSA Free and earn rewards!

Have you used Kir2.2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies