KIR3DL2/CD158k Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09977

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen for Anti-KIR3DL2/CD158k antibody is: synthetic peptide directed towards the C-terminal region of Human KI3L2 (NP_006728.2). Peptide sequence IFLFILLLFFLLYRWCSNKKNAAVMDQEPAGDRTVNRQDSDEQDPQEVTY

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for KIR3DL2/CD158k Antibody - BSA Free

Western Blot: KIR3DL2/CD158k Antibody [NBP3-09977]

Western Blot: KIR3DL2/CD158k Antibody [NBP3-09977]

Western Blot: KIR3DL2/CD158k Antibody [NBP3-09977] - Western blot analysis of KIR3DL2/CD158k in Human Ovary Tumor. Antibody dilution at 1 ug/mL

Applications for KIR3DL2/CD158k Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KIR3DL2/CD158k

Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the 1 Mb leukocyte receptor complex (LRC). The gene content of the KIR gene cluster varies among haplotypes, although several "framework" genes are found in all haplotypes (KIR3DL3, KIR3DP1, KIR3DL4, KIR3DL2). The KIR proteins are classified by the number of extracellular immunoglobulin domains (2D or 3D) and by whether they have a long (L) or short (S) cytoplasmic domain. KIR proteins with the long cytoplasmic domain transduce inhibitory signals upon ligand binding via an immune tyrosine-based inhibitory motif (ITIM), while KIR proteins with the short cytoplasmic domain lack the ITIM motif and instead associate with the TYRO protein tyrosine kinase binding protein to transduce activating signals. The ligands for several KIR proteins are subsets of HLA class I molecules; thus, KIR proteins are thought to play an important role in regulation of the immune response. This gene is one of the "framework" loci that is present on all haplotypes. (provided by RefSeq)

Long Name

Killer Cell Immunoglobulin-like Receptor, Three Domain Long Cytoplasmic Tail, 2

Alternate Names

CD158k, CL-5, NKAT4A, NKAT4B

Gene Symbol

KIR3DL2

Additional KIR3DL2/CD158k Products

Product Documents for KIR3DL2/CD158k Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for KIR3DL2/CD158k Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for KIR3DL2/CD158k Antibody - BSA Free

There are currently no reviews for this product. Be the first to review KIR3DL2/CD158k Antibody - BSA Free and earn rewards!

Have you used KIR3DL2/CD158k Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...