KIR3DS1/CD158e2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09219

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all KIR3DS1/CD158e2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KIR3DS1/CD158e2 (NP_001269100.1). Peptide sequence IMFEHFFLHKEWISKDPSRLVGQIHDGVSKANFSIGSMMRALAGTYRCYG

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for KIR3DS1/CD158e2 Antibody - BSA Free

Western Blot: KIR3DS1/CD158e2 Antibody [NBP3-09219]

Western Blot: KIR3DS1/CD158e2 Antibody [NBP3-09219]

Western Blot: KIR3DS1/CD158e2 Antibody [NBP3-09219] - Western blot analysis of KIR3DS1/CD158e2 in Lung Tumor lysates. Antibody dilution at 1.0ug/ml

Applications for KIR3DS1/CD158e2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KIR3DS1/CD158e2

The KIR family is composed of at least 15 members expressed by natural killer (NK) cells and a subset of T cells in primates only. KIR proteins are named based on the number of extracellular Ig-like domains (KIR2D or KIR3D) and for whether the cytoplasmic domain is long (L), or short (S). Inhibitory KIR proteins possess long cytoplasmic tails with ITIM (inhibitory) domains, and several of these molecules bind HLA Class I molecules or target cells. Activating KIR proteins have short tails; their targets are less well-known. KIR2DL4 (CD158d) is unique in that it shows both inhibitory and activating characteristics.

Long Name

Killer Cell Immunoglobulin-like Receptor, Three Domains, Long Cytoplasmic Tail, 1

Alternate Names

CD158e2, KIR-G1, nkat10

Gene Symbol

KIR3DS1

Additional KIR3DS1/CD158e2 Products

Product Documents for KIR3DS1/CD158e2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for KIR3DS1/CD158e2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for KIR3DS1/CD158e2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review KIR3DS1/CD158e2 Antibody - BSA Free and earn rewards!

Have you used KIR3DS1/CD158e2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies