The KIR family is composed of at least 15 members expressed by natural killer (NK) cells and a subset of T cells in primates only. KIR proteins are named based on the number of extracellular Ig-like domains (KIR2D or KIR3D) and for whether the cytoplasmic domain is long (L), or short (S). Inhibitory KIR proteins possess long cytoplasmic tails with ITIM (inhibitory) domains, and several of these molecules bind HLA Class I molecules or target cells. Activating KIR proteins have short tails; their targets are less well-known. KIR2DL4 (CD158d) is unique in that it shows both inhibitory and activating characteristics.
KIR3DS1/CD158e2 Antibody - BSA Free
Novus Biologicals | Catalog # NBP3-09424
Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit
Format
BSA Free
Loading...
Product Specifications
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human KIR3DS1/CD158e2 (NP_001077008). Peptide sequence GPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADF
Clonality
Polyclonal
Host
Rabbit
Theoretical MW
42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for KIR3DS1/CD158e2 Antibody - BSA Free
Western Blot: KIR3DS1/CD158e2 Antibody [NBP3-09424]
Western Blot: KIR3DS1/CD158e2 Antibody [NBP3-09424] - Western blot analysis of KIR3DS1/CD158e2 in Human Testicular Tumor lysates. Antibody dilution at 1ug/mlApplications for KIR3DS1/CD158e2 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: KIR3DS1/CD158e2
Long Name
Killer Cell Immunoglobulin-like Receptor, Three Domains, Long Cytoplasmic Tail, 1
Alternate Names
CD158e2, KIR-G1, nkat10
Gene Symbol
KIR3DS1
Additional KIR3DS1/CD158e2 Products
Product Documents for KIR3DS1/CD158e2 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for KIR3DS1/CD158e2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for KIR3DS1/CD158e2 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review KIR3DS1/CD158e2 Antibody - BSA Free and earn rewards!
Have you used KIR3DS1/CD158e2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...