KLC3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54771

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all KLC3 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to KLC3(kinesin light chain 3) The peptide sequence was selected from the middle region of KLC3 (NP_8031360). Peptide sequence MLNILALVYRDQNKYKEATDLLHDALQIREQTLGPEHPAVAATLNNLAVL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for KLC3 Antibody - BSA Free

Western Blot: KLC3 Antibody [NBP1-54771]

Western Blot: KLC3 Antibody [NBP1-54771]

Western Blot: KLC3 Antibody [NBP1-54771] - Human Brain lysate, concentration 0.2-1 ug/ml.

Applications for KLC3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KLC3

KLC3 is a member of the kinesin light chain gene family. Kinesins are molecular motors involved in the transport of cargo along microtubules, and are composed of two kinesin heavy chain (KHC) and two kinesin light chain (KLC) molecules. KLCs are thought to typically be involved in binding cargo and regulating kinesin activity. In the rat, a protein similar to this gene product is expressed in post-meiotic spermatids, where it associates with structural components of sperm tails and mitochondria.This gene encodes a member of the kinesin light chain gene family. Kinesins are molecular motors involved in the transport of cargo along microtubules, and are composed of two kinesin heavy chain (KHC) and two kinesin light chain (KLC) molecules. KLCs are thought to typically be involved in binding cargo and regulating kinesin activity. In the rat, a protein similar to this gene product is expressed in post-meiotic spermatids, where it associates with structural components of sperm tails and mitochondria.

Alternate Names

kinesin light chain 3, KLC2, KLC2-like, KLC2Lkinesin light chain 2, KLCt, KNS2B

Entrez Gene IDs

147700 (Human); 232943 (Mouse); 171549 (Rat)

Gene Symbol

KLC3

UniProt

Q6P597 (Human)

Additional KLC3 Products

Product Documents for KLC3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for KLC3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for KLC3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review KLC3 Antibody - BSA Free and earn rewards!

Have you used KLC3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies