KLF11 Antibody - Azide and BSA Free
Novus Biologicals | Catalog # NBP3-15582
Loading...
Key Product Details
Species Reactivity
Mouse, Rat
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 13-107 of human KLF11 (NP_003588.1). RAVDIMDICESILERKRHDSERSTCSILEQTDMEAVEALVCMSSWGQRSQKGDLLRIRPLTPVSDSGDVTTTVHMDAATPELPKDFHSLSTLCIT
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for KLF11 Antibody - Azide and BSA Free
Western Blot: KLF11 AntibodyAzide and BSA Free [NBP3-15582]
Western Blot: KLF11 Antibody [NBP3-15582] - Western blot analysis of extracts of various cell lines, using KLF11 antibody (NBP3-15582) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.Applications for KLF11 Antibody - Azide and BSA Free
Application
Recommended Usage
Western Blot
1:500 - 1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
Azide and BSA Free
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: KLF11
Alternate Names
FKLFFKLF1, Krueppel-like factor 11, Kruppel-like factor 11, MODY7TGFB-inducible early growth response protein 2, TIEG-2, TIEG2TGFB inducible early growth response 2, Tieg3, Transforming growth factor-beta-inducible early growth response protein 2
Gene Symbol
KLF11
Additional KLF11 Products
Product Documents for KLF11 Antibody - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for KLF11 Antibody - Azide and BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.govCustomer Reviews for KLF11 Antibody - Azide and BSA Free
There are currently no reviews for this product. Be the first to review KLF11 Antibody - Azide and BSA Free and earn rewards!
Have you used KLF11 Antibody - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...