KLF11 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-15582

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all KLF11 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 13-107 of human KLF11 (NP_003588.1). RAVDIMDICESILERKRHDSERSTCSILEQTDMEAVEALVCMSSWGQRSQKGDLLRIRPLTPVSDSGDVTTTVHMDAATPELPKDFHSLSTLCIT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for KLF11 Antibody - Azide and BSA Free

Western Blot: KLF11 AntibodyAzide and BSA Free [NBP3-15582]

Western Blot: KLF11 AntibodyAzide and BSA Free [NBP3-15582]

Western Blot: KLF11 Antibody [NBP3-15582] - Western blot analysis of extracts of various cell lines, using KLF11 antibody (NBP3-15582) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Applications for KLF11 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: KLF11

Transcription factor. Activates the epsilon- and gamma-globin gene promoters and, to a much lower degree, the beta-globin gene and represses promoters containing SP1-like binding inhibiting cell growth. Represses transcription of SMAD7 which enhances TGF-beta signaling. Induces apoptosis

Alternate Names

FKLFFKLF1, Krueppel-like factor 11, Kruppel-like factor 11, MODY7TGFB-inducible early growth response protein 2, TIEG-2, TIEG2TGFB inducible early growth response 2, Tieg3, Transforming growth factor-beta-inducible early growth response protein 2

Gene Symbol

KLF11

Additional KLF11 Products

Product Documents for KLF11 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for KLF11 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for KLF11 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review KLF11 Antibody - Azide and BSA Free and earn rewards!

Have you used KLF11 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies