KLF15 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84119

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all KLF15 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KLF15. Peptide sequence: GPIPVLLQIQPVPVKQESGTGPASPGQAPENVKVAQLLVNIQGQTFALVP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for KLF15 Antibody - BSA Free

Western Blot: KLF15 Antibody [NBP2-84119]

Western Blot: KLF15 Antibody [NBP2-84119]

Western Blot: KLF15 Antibody [NBP2-84119] - WB Suggested Anti-KLF15 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human Spleen

Applications for KLF15 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KLF15

The kidney chloride channel proteins CLCNKA and CLCNKB are highly related, although they are located in different areas of the kidney. Using a yeast 1-hybrid screen of a kidney cDNA library with the GA element of the CLCNKA promoter as bait, Uchida et al. (2000) isolated cDNAs encoding MAZ and KLF15, which they termed KKLF. Sequence analysis predicted that the 415-amino acid KLF15 protein, which is 84% identical to the rat Klf15 protein, contains 3 zinc finger motifs at its C terminus, N-terminal serine-rich stretches, and a central proline-rich segment. EMSA analysis confirmed that KLF15 and MAZ interact with the GA element of the CLCNKA promoter and showed that KLF15 binds with higher affinity and is a functional competitor of MAZ. Northern blot analysis revealed highest expression of a 2.5-kb KLF15 transcript in liver, followed by heart, skeletal muscle, and kidney. No expression was found in bone marrow or lymphoid tissues. Western blot analysis showed expression of a 50-kD protein. Immunohistochemical analysis detected nuclear expression of KLF15 in liver sinusoid stellate cells, subcapsular fibroblasts, and portal fibroblasts. KLF15 was also expressed in cardiac and skeletal muscle interstitial cells and in kidney inner medulla, glomeruli, and cortical interstitium. Immunofluorescence microscopy, however, demonstrated no colocalization of KLF15 with CLCNKA.

Alternate Names

DKFZp779M1320, kidney-enriched Kruppel-like factor, KKLFKidney-enriched krueppel-like factor, Krueppel-like factor 15, Kruppel-like factor 15

Gene Symbol

KLF15

Additional KLF15 Products

Product Documents for KLF15 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for KLF15 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for KLF15 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review KLF15 Antibody - BSA Free and earn rewards!

Have you used KLF15 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies