Klotho Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55097

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Klotho Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to KL(klotho) The peptide sequence was selected from the n terminal of KL (BAA24941). Peptide sequence FPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAPPGDSRNASLP. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Klotho Antibody - BSA Free

Western Blot: Klotho Antibody [NBP1-55097]

Western Blot: Klotho Antibody [NBP1-55097]

Western Blot: Klotho Antibody [NBP1-55097] - Titration: 0.2-1 ug/ml, Positive Control: Human Thymus.

Applications for Klotho Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Klotho

This gene encodes a type-I membrane protein that is related to beta-glucosidases. Reduced production of this protein has been observed in patients with chronic renal failure (CRF), and this may be one of the factors underlying the degenerative processes (

Alternate Names

KL

Entrez Gene IDs

9365 (Human)

Gene Symbol

KL

UniProt

Q9UEF7

Additional Klotho Products

Product Documents for Klotho Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Klotho Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Klotho Antibody - BSA Free

Customer Reviews for Klotho Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Klotho Antibody - BSA Free and earn rewards!

Have you used Klotho Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for Klotho Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All

  • Q: I study physiology (PhD) and I need a klotho kit.

    A: A list of our klotho products can be found here. I am not entirely sure what you are looking for as I don't have your complete message for some reason. Can you please clarify what you are looking for?

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies