Ku80/XRCC5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55954

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Ku80/XRCC5 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQD

Reactivity Notes

Mouse 85%, Rat 83%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Ku80/XRCC5 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Ku80/XRCC5 Antibody [NBP2-55954]

Immunocytochemistry/ Immunofluorescence: Ku80/XRCC5 Antibody [NBP2-55954]

Immunocytochemistry/Immunofluorescence: Ku80/XRCC5 Antibody [NBP2-55954] - Staining of human cell line SH-SY5Y shows localization to nucleoplasm.

Applications for Ku80/XRCC5 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Ku80/XRCC5

Ku80, also known as XRCC5, plays a role in many diverse processes including cell signaling, proliferation, DNA repair, replication, transcriptional activation and apoptosis.

As one half of the heterodimer complex Ku, Ku80 is required for proper maintenance of the telomeric C strand. Ku80 also plays a role in DNA repair as an essential subunit of DNA-dependent protein kinase (DNA-PK) that phosphorylates certain transcription factors (Sp1, Oct-1 and p53). The heterodimer Ku binds double stranded DNA breaks for non-homologous end joining repair. Ku mutants are defective in T-DNA integration and over-expression confers increased resistance to DNA damage agents and increased susceptibility to T-DNA transformation.

Long Name

Lupus Ku Autoantigen Protein 86

Alternate Names

CTC85, G22P2, KARP1, Ku86, KUB2, NFIV, XRCC5

Gene Symbol

XRCC5

Additional Ku80/XRCC5 Products

Product Documents for Ku80/XRCC5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Ku80/XRCC5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Ku80/XRCC5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Ku80/XRCC5 Antibody - BSA Free and earn rewards!

Have you used Ku80/XRCC5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies