Kv11.2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84126

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Kv11.2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human Kv11.2. Peptide sequence: LSTLYFISRGSIEILRDDVVVAILGKNDIFGEPVSLHAQPGKSSADVRAL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Kv11.2 Antibody - BSA Free

Western Blot: Kv11.2 Antibody [NBP2-84126]

Western Blot: Kv11.2 Antibody [NBP2-84126]

Western Blot: Kv11.2 Antibody [NBP2-84126] - WB Suggested Anti-KCNH6 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:12500. Positive Control: HepG2 cell lysate

Applications for Kv11.2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Kv11.2

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit. Several alternatively spliced transcript variants have been identified from this gene, but the full-length nature of only two transcript variants has been determined. [provided by RefSeq]

Long Name

Potassium voltage-gated channel subfamily H member 6

Alternate Names

ERG-2, ERG2, hERG-2, hERG2, KCNH6

Gene Symbol

KCNH6

Additional Kv11.2 Products

Product Documents for Kv11.2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Kv11.2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Kv11.2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Kv11.2 Antibody - BSA Free and earn rewards!

Have you used Kv11.2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies