Kv1.6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-24946

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (92%), Rat (90%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Kv1.6 Primary Antibodies »

Product Specifications

Immunogen

This antibody has been engineered to specifically recognize the recombinant protein Kv1.6 using the following amino acid sequence: EQGQYTHVTCGQPAPDLRATDNGLGKPDFPEANRERRPSYLPTPHRAYAE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Kv1.6 Antibody - BSA Free

Kv1.6 Antibody Immunocytochemistry/Immunofluorescence: Kv1.6 Antibody [NBP3-24946]

Immunocytochemistry/Immunofluorescence: Kv1.6 Antibody [NBP3-24946]

Staining of human cell line SuSa shows localization to plasma membrane & cytosol.

Applications for Kv1.6 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 µg/ml
Application Notes
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Kv1.6

Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homologs. This protein is a member of the potassium channel, voltage-gated, shaker-related subfamily. Kv1.6 contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class. The coding region of this gene is intronless, and the gene is clustered with genes KCNA1 and KCNA5 on chromosome 12. Kv1.6 is a homologue of the Drosophila gene Shaker, which is involved in reduced sleep and life expectancy.

Long Name

Potassium voltage-gated channel subfamily A member 6

Alternate Names

KCNA6

Gene Symbol

KCNA6

Additional Kv1.6 Products

Product Documents for Kv1.6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Kv1.6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Kv1.6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Kv1.6 Antibody - BSA Free and earn rewards!

Have you used Kv1.6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies