Kv7.2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85191

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Kv7.2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human Kv7.2. Peptide sequence: SIAVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAH The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Kv7.2 Antibody - BSA Free

Western Blot: Kv7.2 Antibody [NBP2-85191]

Western Blot: Kv7.2 Antibody [NBP2-85191]

Western Blot: Kv7.2 Antibody [NBP2-85191] - WB Suggested Anti-KCNQ2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: NCI-H226 cell lysateThere is BioGPS gene expression data showing that KCNQ2 is expressed in NCIH226
Immunohistochemistry: Kv7.2 Antibody [NBP2-85191]

Immunohistochemistry: Kv7.2 Antibody [NBP2-85191]

Immunohistochemistry: Kv7.2 Antibody [NBP2-85191] - Immunohistochemistry with Brain, cerebellum tissue at an antibody concentration of 5ug/ml using anti-KCNQ2 antibody
Western Blot: Kv7.2 Antibody [NBP2-85191]

Western Blot: Kv7.2 Antibody [NBP2-85191]

Western Blot: Kv7.2 Antibody [NBP2-85191] - Host: Mouse. Target Name: KCNQ2. Sample Tissue: Mouse Liver. Antibody Dilution: 1ug/ml

Applications for Kv7.2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Kv7.2

KCNQs are members of the voltage dependent non inactivating potassium channel family. Currently there are five known KCNQs (KCNQ1 to 5) found in the central nervous system and KCNQ2 and 3 have demonstrated their importance in M current activation. Studies have shown that KCNQ2 and KCNQ3 form heteromultimers that, when formed, substantially increase the M current. Inhibition of M current controls neuron excitability throughout the nervous system as well as the responsiveness to synaptic inputs. Genetic mutations in these proteins have been linked to disorders such as benign familial neonatal convulsions (BFNC), deafness, neuropathic pain and epilepsy.

Long Name

Potassium voltage-gated channel subfamily KQT member 2

Alternate Names

KCNQ2, KQT-like 2

Gene Symbol

KCNQ2

Additional Kv7.2 Products

Product Documents for Kv7.2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Kv7.2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Kv7.2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Kv7.2 Antibody - BSA Free and earn rewards!

Have you used Kv7.2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies