KvBeta1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86698

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all KvBeta1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human KvBeta1. Peptide sequence: VPESSRASLKCYQWLKERIVSEEGRKQQNKLKDLSPIAERLGCTLPQLAV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for KvBeta1 Antibody - BSA Free

Western Blot: KvBeta1 Antibody [NBP2-86698]

Western Blot: KvBeta1 Antibody [NBP2-86698]

Western Blot: KvBeta1 Antibody [NBP2-86698] - WB Suggested Anti-KCNAB1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human kidney

Applications for KvBeta1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KvBeta1

Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member includes three distinct isoforms which are encoded by three alternatively spliced transcript variants of this gene. These three isoforms are beta subunits, which form heteromultimeric complex with alpha subunits and modulate the activity of the pore-forming alpha subunits. (provided by RefSeq)

Alternate Names

AKR6A3, hKvb3, hKvBeta3, K(+) channel subunit beta-1, KCNA1Bpotassium channel beta 3 chain, Kvb1.3, KV-BETA-1, potassium channel beta3 subunit, potassium channel shaker chain beta 1a, potassium voltage-gated channel beta subunit, potassium voltage-gated channel, shaker-related subfamily, beta member 1, voltage-gated potassium channel beta-1 subunit, voltage-gated potassium channel subunit beta-1

Gene Symbol

KCNAB1

Additional KvBeta1 Products

Product Documents for KvBeta1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for KvBeta1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for KvBeta1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review KvBeta1 Antibody - BSA Free and earn rewards!

Have you used KvBeta1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies