KvBeta3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58857

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all KvBeta3 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ('CGLITSKYDGRVPDTCRASIKGYQWLKDKVQSEDGKKQQAKVMDLLPVAHQ',)

Reactivity Notes

Mouse 84%, Rat 80%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for KvBeta3 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: KvBeta3 Antibody [NBP2-58857]

Immunocytochemistry/ Immunofluorescence: KvBeta3 Antibody [NBP2-58857]

Immunocytochemistry/Immunofluorescence: KvBeta3 Antibody [NBP2-58857] - Staining of human cell line U-2 OS shows localization to mitochondria.

Applications for KvBeta3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KvBeta3

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits. This member and the KCNA5 gene product assemble into a heteromultimeric A-type channel that inactivates completely and is significantly faster than other A-type Kv channels. (provided by RefSeq)

Alternate Names

AKR6A9, K(+) channel subunit beta-3, KCNA3.1B, KCNA3BK+ channel beta-3 subunit, KV-BETA-3, MGC116886, potassium channel, voltage-dependent, beta-3 subunit, potassium voltage-gated channel, shaker-related subfamily, beta member 3, voltage-gated potassium channel subunit beta-3

Gene Symbol

KCNAB3

Additional KvBeta3 Products

Product Documents for KvBeta3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for KvBeta3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for KvBeta3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review KvBeta3 Antibody - BSA Free and earn rewards!

Have you used KvBeta3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies