Lactoferrin Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38885

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: PNHAVVSRMDKVERLKQVLLHQQAKFGRNGSDCPDKFCLFQSETKNLLFNDNTECLARLHGK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Lactoferrin Antibody - BSA Free

Immunohistochemistry-Paraffin: Lactoferrin Antibody [NBP2-38885]

Immunohistochemistry-Paraffin: Lactoferrin Antibody [NBP2-38885]

Immunohistochemistry-Paraffin: Lactoferrin Antibody [NBP2-38885] - Staining in human salivary gland and liver tissues using NBP2-38885 antibody. Corresponding LTF RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Lactoferrin Antibody [NBP2-38885]

Immunohistochemistry-Paraffin: Lactoferrin Antibody [NBP2-38885]

Immunohistochemistry-Paraffin: Lactoferrin Antibody [NBP2-38885] - Staining of human lactating breast shows strong positivity.
Immunohistochemistry-Paraffin: Lactoferrin Antibody [NBP2-38885]

Immunohistochemistry-Paraffin: Lactoferrin Antibody [NBP2-38885]

Immunohistochemistry-Paraffin: Lactoferrin Antibody [NBP2-38885] - Staining of human endometrium shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: Lactoferrin Antibody [NBP2-38885]

Immunohistochemistry-Paraffin: Lactoferrin Antibody [NBP2-38885]

Immunohistochemistry-Paraffin: Lactoferrin Antibody [NBP2-38885] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Lactoferrin Antibody [NBP2-38885]

Immunohistochemistry-Paraffin: Lactoferrin Antibody [NBP2-38885]

Immunohistochemistry-Paraffin: Lactoferrin Antibody [NBP2-38885] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Lactoferrin Antibody [NBP2-38885]

Immunohistochemistry-Paraffin: Lactoferrin Antibody [NBP2-38885]

Immunohistochemistry-Paraffin: Lactoferrin Antibody [NBP2-38885] - Staining of human salivary gland shows moderate cytoplasmic positivity in glandular cells.

Applications for Lactoferrin Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Lactoferrin

Lactoferrin is an iron binding glycoprotein with an approximate molecular weight of 80 kDa. The protein has two iron binding domains each housing one Fe3+ and the synergistic CO32- ion. The crystal structure form of human lactoferrin at 2.2A resolution exhibits 5330 protein atoms, 2Fe2+, 2CO32- and 98 carbohydrate atoms. Lactoferrin is absorbed from intestine by apical side of the membrane and localized to the nuclei. Intravenous infusion of lactoferrin is protective against lethal doses of E coli and induce bacterimia by a mechanism that downregulates neutrophil TNF alfa secretion. Recombinant human lactoferrin (rhLF), expressed and extracted from rice seed, is being evaluated for use as a dietary supplement to treat iron deficiency and/or iron deficiency induced anemia. Lactoferrin has been shown to have a role in the immune system and in early development of the embryo. A specific receptor for lactoferrin binding has been implicated in the human fetal intestine. Early embryonic localisation of lactoferrin by IHC has suggested its presence in various tissues including intestinal epitheliuem, kiney, and various regions of the brain.

Alternate Names

GIG12, HEL110, HLF2, Kaliocin-1, Lactoferricin, Lactoferroxin, Lactotransferrin, LF, LTF, Talalactoferrin

Gene Symbol

LTF

UniProt

Additional Lactoferrin Products

Product Documents for Lactoferrin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Lactoferrin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Lactoferrin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Lactoferrin Antibody - BSA Free and earn rewards!

Have you used Lactoferrin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...