LAT3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59431

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all LAT3 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to SLC43A1(solute carrier family 43, member 1) The peptide sequence was selected from the middle region of SLC43A1. Peptide sequence AVNKMLEYLVTGGQEHETNEQQQKVAETVGFYSSVFGAMQLLCLLTCPLI. The peptide sequence for this immunogen was taken from within the described region.

Specificity

This product is specific to Subunit or Isoform: 3.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

61 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for LAT3 Antibody - BSA Free

Western Blot: LAT3 Antibody [NBP1-59431]

Western Blot: LAT3 Antibody [NBP1-59431]

Western Blot: LAT3 Antibody [NBP1-59431] - Sample Type: Human Fetal Liver Antibody Dilution: 1.0 ug/ml
Western Blot: LAT3 Antibody [NBP1-59431]

Western Blot: LAT3 Antibody [NBP1-59431]

Western Blot: LAT3 Antibody [NBP1-59431] - Human Placenta lysate, concentration 0.2-1 ug/ml.

Applications for LAT3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LAT3

SLC43A1 belongs to the system L family of plasma membrane carrier proteins that transports large neutral amino acids.SLC43A1 belongs to the system L family of plasma membrane carrier proteins that transports large neutral amino acids (Babu et al., 2003 [PubMed 12930836]).[supplied by OMIM].

Alternate Names

LAT3prostate cancer overexpressed gene 1, PB39L-type amino acid transporter 3, POV1large neutral amino acids transporter small subunit 3, Prostate cancer overexpressed gene 1 protein, R00504, Solute carrier family 43 member 1, solute carrier family 43, member 1

Gene Symbol

SLC43A1

UniProt

O75387 (Human)

Additional LAT3 Products

Product Documents for LAT3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for LAT3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for LAT3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review LAT3 Antibody - BSA Free and earn rewards!

Have you used LAT3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies