Latrophilin 1/LPHN1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85609

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Latrophilin 1/LPHN1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: GNHLLTNPVLQPRGGTSPYNTLIAESVGFNPSSPPVFNSPGSYREPKHPLGGREACGMDTLP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Latrophilin 1/LPHN1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Latrophilin 1/LPHN1 Antibody [NBP1-85609]

Immunohistochemistry-Paraffin: Latrophilin 1/LPHN1 Antibody [NBP1-85609]

Immunohistochemistry-Paraffin: Latrophilin 1/LPHN1 Antibody [NBP1-85609] - Staining of human prostate shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: Latrophilin 1/LPHN1 Antibody [NBP1-85609]

Immunohistochemistry-Paraffin: Latrophilin 1/LPHN1 Antibody [NBP1-85609]

Immunohistochemistry-Paraffin: Latrophilin 1/LPHN1 Antibody [NBP1-85609] - Staining of human Fallopian tube shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: Latrophilin 1/LPHN1 Antibody [NBP1-85609]

Immunohistochemistry-Paraffin: Latrophilin 1/LPHN1 Antibody [NBP1-85609]

Immunohistochemistry-Paraffin: Latrophilin 1/LPHN1 Antibody [NBP1-85609] - Staining of human cerebral cortex shows moderate positivity in neuropil.
Immunohistochemistry-Paraffin: Latrophilin 1/LPHN1 Antibody [NBP1-85609]

Immunohistochemistry-Paraffin: Latrophilin 1/LPHN1 Antibody [NBP1-85609]

Immunohistochemistry-Paraffin: Latrophilin 1/LPHN1 Antibody [NBP1-85609] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Applications for Latrophilin 1/LPHN1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Latrophilin 1/LPHN1

Latrophilin-1 is a brain-specific Orphan-B Receptor that binds alpha-latrotoxin, a potent presynaptic neurotoxin present in the venom of the black widow spider, in a Ca2+-independent manner. As with the other two latrophilins, it shares homology with lectin, olfactomedin, and transmembrane domains, and possesses variable C-termini and various alternative-splicing sites. CIRL is endogenously cleaved into two pieces at the GPCR proteolytic site (GPS) located adjacent to the first transmembrane helix as a mechanism to compartmentalize the cell adhesion and GPCR activation functions. Latrophilin-1 has been reported to be expressed predominantly in the brain. Very weak expression has also been documented in human heart, placenta, lung, liver, skeletal muscle, kidney, and pancreas. ESTs have been isolated from brain, eye, kidney, lung, and lymph node libraries. In addition, ESTs have been isolated from the following cancer libraries: brain, choriocarcinoma, epithelioid carcinoma, kidney, and lung.

Alternate Names

CIRL1, LEC2, Lectomedin-2, LPHN1

Gene Symbol

ADGRL1

Additional Latrophilin 1/LPHN1 Products

Product Documents for Latrophilin 1/LPHN1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Latrophilin 1/LPHN1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Latrophilin 1/LPHN1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Latrophilin 1/LPHN1 Antibody - BSA Free and earn rewards!

Have you used Latrophilin 1/LPHN1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies