Latrophilin 1/LPHN1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87717

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human Latrophilin 1/LPHN1. Peptide sequence: YSLRSGDFPPGDGGPEPPRGRNLADAAAFEKMIISELVHNNLRGSSSAAK The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Latrophilin 1/LPHN1 Antibody - BSA Free

Western Blot: Latrophilin 1/LPHN1 Antibody [NBP2-87717]

Western Blot: Latrophilin 1/LPHN1 Antibody [NBP2-87717]

Western Blot: Latrophilin 1/LPHN1 Antibody [NBP2-87717] - WB Suggested Anti-LPHN1 Antibody. Titration: 1.0 ug/ml. Positive Control: Hela Whole Cell

Applications for Latrophilin 1/LPHN1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Latrophilin 1/LPHN1

Latrophilin-1 is a brain-specific Orphan-B Receptor that binds alpha-latrotoxin, a potent presynaptic neurotoxin present in the venom of the black widow spider, in a Ca2+-independent manner. As with the other two latrophilins, it shares homology with lectin, olfactomedin, and transmembrane domains, and possesses variable C-termini and various alternative-splicing sites. CIRL is endogenously cleaved into two pieces at the GPCR proteolytic site (GPS) located adjacent to the first transmembrane helix as a mechanism to compartmentalize the cell adhesion and GPCR activation functions. Latrophilin-1 has been reported to be expressed predominantly in the brain. Very weak expression has also been documented in human heart, placenta, lung, liver, skeletal muscle, kidney, and pancreas. ESTs have been isolated from brain, eye, kidney, lung, and lymph node libraries. In addition, ESTs have been isolated from the following cancer libraries: brain, choriocarcinoma, epithelioid carcinoma, kidney, and lung.

Alternate Names

CIRL1, LEC2, Lectomedin-2, LPHN1

Gene Symbol

ADGRL1

Additional Latrophilin 1/LPHN1 Products

Product Documents for Latrophilin 1/LPHN1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Latrophilin 1/LPHN1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Latrophilin 1/LPHN1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Latrophilin 1/LPHN1 Antibody - BSA Free and earn rewards!

Have you used Latrophilin 1/LPHN1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...