LCLAT1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89204

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (90%), Rat (91%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all LCLAT1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LHPRTTGFTFVVDRLREGKNLDAVHDITVAYPHNIPQSEKHLLQGDFPREIHFHVHRYPIDTLPTSKEDLQLWCHKR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for LCLAT1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: LCLAT1 Antibody [NBP1-89204]

Immunocytochemistry/ Immunofluorescence: LCLAT1 Antibody [NBP1-89204]

Immunocytochemistry/Immunofluorescence: LCLAT1 Antibody [NBP1-89204] - Staining of human cell line A-431 shows localization to endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: LCLAT1 Antibody [NBP1-89204]

Immunohistochemistry-Paraffin: LCLAT1 Antibody [NBP1-89204]

Immunohistochemistry-Paraffin: LCLAT1 Antibody [NBP1-89204] - Staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: LCLAT1 Antibody [NBP1-89204]

Immunohistochemistry-Paraffin: LCLAT1 Antibody [NBP1-89204]

Immunohistochemistry-Paraffin: LCLAT1 Antibody [NBP1-89204] - Staining of human fallopian tube shows weak to cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: LCLAT1 Antibody [NBP1-89204]

Immunohistochemistry-Paraffin: LCLAT1 Antibody [NBP1-89204]

Immunohistochemistry-Paraffin: LCLAT1 Antibody [NBP1-89204] - Staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: LCLAT1 Antibody [NBP1-89204]

Immunohistochemistry-Paraffin: LCLAT1 Antibody [NBP1-89204]

Immunohistochemistry-Paraffin: LCLAT1 Antibody [NBP1-89204] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.

Applications for LCLAT1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LCLAT1

Acyl-CoA:lysocardiolipin acyltransferase. Possesses both lysophosphatidylinositol acyltransferase (LPIAT) andlysophosphatidylglycerol acyltransferase (LPGAT) activities. Recognizes both monolysocardiolipin and dilysocardiolipinas substrates with a preference for linoleoyl-CoA and oleoyl-CoA as acyl donors. Acts as a remodeling enzyme forcardiolipin, a major membrane polyglycerophospholipid. Converts lysophosphatidic acid (LPA) into phosphatidic acid(PA) with a relatively low activity. Required for establishment of the hematopoietic and endothelial lineages

Alternate Names

1-acylglycerol-3-phosphate O-acyltransferase 8, 1-AGPAT 8, Acyl-CoA:lysocardiolipin acyltransferase 1, AGPAT8lysocardiolipin acyltransferase, ALCAT11AGPAT8, EC 2.3.1.-, EC 2.3.1.51, FLJ37965, HSRG1849, LYCAT, lysocardiolipin acyltransferase 1, UNQ1849,1-AGP acyltransferase 8

Gene Symbol

LCLAT1

Additional LCLAT1 Products

Product Documents for LCLAT1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for LCLAT1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for LCLAT1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review LCLAT1 Antibody - BSA Free and earn rewards!

Have you used LCLAT1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies