Lhx8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87722

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Lhx8 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Lhx8. Peptide sequence: MSEECGRPAALAAGRTRKGAGEEGLVNPEGAGDEDSCSSSAPLSPSSSPQ The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Lhx8 Antibody - BSA Free

Western Blot: Lhx8 Antibody [NBP2-87722]

Western Blot: Lhx8 Antibody [NBP2-87722]

Western Blot: Lhx8 Antibody [NBP2-87722] - Host: Rabbit. Target Name: Lhx8. Sample Type: Rat Thymus lysates. Antibody Dilution: 1.0ug/ml

Applications for Lhx8 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Lhx8

Members of the LIM homeobox gene family, such as LHX8, encode transcription regulators that share common structuralfeatures. They all contain 2 tandemly repeated cysteine-rich double-zinc finger motifs, called LIM domains, inaddition to a homeodomain. The homeodomain is a DNA-binding domain, and the LIM domains are essential for regulatingthe activity of these molecules by interacting with other proteins. Members of the LIM homeobox gene family arerequired for the patterning or the specification and differentiation of different cell types during embryonicdevelopment (Zhao et al., 1999 (PubMed 10611327)).(supplied by OMIM)

Alternate Names

LIM homeobox 8, LIM homeobox protein 8

Gene Symbol

LHX8

Additional Lhx8 Products

Product Documents for Lhx8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Lhx8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Lhx8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Lhx8 Antibody - BSA Free and earn rewards!

Have you used Lhx8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies