LIMS2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85209

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all LIMS2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human LIMS2. Peptide sequence: DVELADLGFVKNAGRHLCRPCHNREKAKGLGKYICQRCHLVIDEQPLMFR The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for LIMS2 Antibody - BSA Free

Western Blot: LIMS2 Antibody [NBP2-85209]

Western Blot: LIMS2 Antibody [NBP2-85209]

Western Blot: LIMS2 Antibody [NBP2-85209] - WB Suggested Anti-LIMS2 Antibody. Titration: 1.0 ug/ml. Positive Control: MCF7 Whole Cell
Western Blot: LIMS2 Antibody [NBP2-85209]

Western Blot: LIMS2 Antibody [NBP2-85209]

Western Blot: LIMS2 Antibody [NBP2-85209] - Host: Rabbit. Target: LIMS2. Positive control (+): Human Fetal Heart (HE). Negative control (-): Human Brain (BR). Antibody concentration: 1ug/ml

Applications for LIMS2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LIMS2

LIMS2 is a focal adhesion protein that associates with integrin-linked kinase (ILK; MIM 602366), a multidomain protein that mediates multiple protein-protein interactions at adhesion sites between cells and the extracellular matrix (ECM).(supplied by OMIM)

Alternate Names

FLJ10044, ILK-binding protein, LIM and senescent cell antigen-like domains 2, LIM and senescent cell antigen-like-containing domain protein 2, LIM-like protein 2, Particularly interesting new Cys-His protein 2, PINCH2, PINCH-2

Gene Symbol

LIMS2

Additional LIMS2 Products

Product Documents for LIMS2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for LIMS2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for LIMS2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review LIMS2 Antibody - BSA Free and earn rewards!

Have you used LIMS2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies