Lipoprotein a Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79805

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Lipoprotein a Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human LPA (EAW47596). Peptide sequence VPDPSTEASSEEAPTEQSPGVQDCYHGDGQSYRGSFSTTVTGRTCQSWSS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

120 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Lipoprotein a Antibody - BSA Free

Western Blot: Lipoprotein a Antibody [NBP1-79805]

Western Blot: Lipoprotein a Antibody [NBP1-79805]

Western Blot: Lipoprotein a Antibody [NBP1-79805] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Applications for Lipoprotein a Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Lipoprotein a

The protein encoded by the Lipoprotein a gene is a serine proteinase that inhibits the activity of tissue-type plasminogen activator I. The encoded protein constitutes a substantial portion of lipoprotein(a) and is proteolytically cleaved, resulting in fragments that attach to atherosclerotic lesions and promote thrombogenesis. Elevated plasma levels of this protein are linked to atherosclerosis. Depending on the individual, the encoded protein contains 2-43 copies of kringle-type domains. The allele represented here contains 15 copies of the kringle-type repeats and corresponds to that found in the reference genome sequence. (provided by RefSeq)

Alternate Names

AK38, antiangiogenic AK38 protein, Apo(a), APOA, apolipoprotein(a), EC 3.4.21, EC 3.4.21.-, EC 3.4.21.7, lipoprotein, Lp(a), LP, Lp(a)

Entrez Gene IDs

4018 (Human)

Gene Symbol

LPA

UniProt

P08519 (Human)

Additional Lipoprotein a Products

Product Documents for Lipoprotein a Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Lipoprotein a Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Lipoprotein a Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Lipoprotein a Antibody - BSA Free and earn rewards!

Have you used Lipoprotein a Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies