LMBRD1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85219

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all LMBRD1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human LMBRD1. Peptide sequence: FWFFSAAYYFGNWAFLGVFLIGLIVSCCKGKKSVIEGVDEDSDISDDEPS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for LMBRD1 Antibody - BSA Free

Western Blot: LMBRD1 Antibody [NBP2-85219]

Western Blot: LMBRD1 Antibody [NBP2-85219]

Western Blot: LMBRD1 Antibody [NBP2-85219] - Host: Rabbit. Target Name: LMBRD1. Sample Tissue: Human Ovary Tumor lysates. Antibody Dilution: 1ug/ml

Applications for LMBRD1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LMBRD1

The LMBRD1 gene encodes a lysosomal membrane protein that may be involved in the transport and metabolism of cobalamin. This protein also interacts with the large form of the hepatitis delta antigen and may be required for the nucleocytoplasmic shuttling of the

Alternate Names

bA810I22.1, C6orf209, chromosome 6 open reading frame 209, FLJ11240, FLJ11854, HDAg-L-interacting protein NESI, hepatitis delta antigen-L interacting protein, liver regeneration p-53 related protein, LMBD1, LMBR1 domain containing 1, LMBR1 domain-containing protein 1, NESIcblF, Nuclear export signal-interacting protein, probable lysosomal cobalamin transporter

Gene Symbol

LMBRD1

Additional LMBRD1 Products

Product Documents for LMBRD1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for LMBRD1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for LMBRD1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review LMBRD1 Antibody - BSA Free and earn rewards!

Have you used LMBRD1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies