LMO7 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09978

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all LMO7 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human LMO7 (NP_001293009.1). Peptide sequence VEPKTALPFNRFLPNKSRQPSYVPAPLRKKKPDKHEDNRRSWASPVYTEA

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

193 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for LMO7 Antibody - BSA Free

Western Blot: LMO7 Antibody [NBP3-09978]

Western Blot: LMO7 Antibody [NBP3-09978]

Western Blot: LMO7 Antibody [NBP3-09978] - Western blot analysis of LMO7 in Human HepG2 Whole Cell. Antibody dilution at 1.0ug/ml

Applications for LMO7 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LMO7

LMO7 contains a calponin homology (CH) domain, a PDZ domain, and a LIM domain. An F-box (FBX) domain is present in alternative splice variants. Members of the LIM protein family carry the LIM domain, a unique cysteine-rich zinc-binding domain. Members of the FBX protein family are involved in protein-protein interactions. The encoded protein may be involved in protein-protein interactions. Multiple alternative splice variants have been described but their full-length sequences have not been determined.

Alternate Names

FBX20F-box only protein 20, KIAA0858FBXO20F-box protein Fbx20, LIM domain 7, LIM domain only 7, LIM domain only protein 7, LMO-7, LOMP, zinc-finger domain-containing protein

Gene Symbol

LMO7

Additional LMO7 Products

Product Documents for LMO7 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for LMO7 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for LMO7 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review LMO7 Antibody - BSA Free and earn rewards!

Have you used LMO7 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies